If students sit 4 per row on a rollercoaster, 6 students are left without a seat.
If they sit 6 per row, there are 3 rows left empty. How many students are
there?

Answers

Answer 1

An expression is defined as a set of numbers, variables, and mathematical operations. The total number of students is 54.

What is an Expression?

In mathematics, an expression is defined as a set of numbers, variables, and mathematical operations formed according to rules dependent on the context.

Let the number of columns in the rollercoaster be represented by x.

If students sit 4 per row on a rollercoaster, 6 students are left without a seat. Therefore, the number of students can be written as,

Total number of students = 4x + 6

If they sit 6 per row, there are 3 rows left empty. Therefore, the total number of students can be written as,

Total number of students = 6(x-3)

The total number of students can be written as,

4x + 6 = 6(x - 3)

4x + 6 = 6x - 18

2x = 24

x = 12

Now, the total number of students in the class are,

4x + 6 = 4(12) + 6 = 54

Hence, the total number of students are 54.

Learn more about Expression:

https://brainly.com/question/13947055

#SPJ1


Related Questions

Solve for x
3x² - 5x + 6 = 10 - 4x​

Answers

Answer: [tex]-1, \frac{4}{3}[/tex]

Step-by-step explanation:

[tex]3x^{2}-5x+6=10-4x\\\\3x^{2}-x-4=0\\ \\ (x+1)(3x-4)=0 \\ \\ x=\boxed{-1, \frac{4}{3}}[/tex]

Answer:

x = -1
x = 4/3

Step-by-step explanation:

Hello!

First, let's convert the equation into Standard Form: [tex]ax^2 + bx + c = 0[/tex]

[tex]3x^2 - 5x + 6 = 10 - 4x[/tex][tex]3x^2 - x - 4 = 0[/tex]

We can solve this by factoring the quadratic. We have to find two numbers that multiply to [tex]ac[/tex] but add up to [tex]b[/tex].

ac = -12b = -1

The two numbers would be -4 and 3. We can expand -x to -4x + 3x, and then factor by grouping.

Factor[tex]3x^2 - x - 4 = 0[/tex][tex]3x^2 +3x - 4x - 4 = 0[/tex][tex]3x(x + 1) - 4(x + 1) = 0[/tex][tex](3x - 4)(x + 1) = 0[/tex]

Use the Zero Product Property. Set each factor to zero and solve for x.

3x - 4 = 03x = 4x = 4/3

x + 1 = 0x = -1

The solutions to the quadratic are -1 and 4/3.

HELP ANGJHHGG plssssssssssssssssssfghgg

Answers

Answer:

5377

Step-by-step explanation:

this is a vector question where how far is the Resultant. that is, it is determined by the magnitude of the Hypotenuse.

using Pythagoras theorem

Hypotenuse ²= Opposite ²+Adjacent²

Hypotenuse ²= 2865²+4550²

Hypotenuse ²= 8208225+20702500

Hypotenuse ²=28910725

Hypotenuse=√28910725

Hypotenuse=5376.86944234282

Hypotenuse= 5377 approximated


Find the lengths of sides marked with variables (x, y, w, z). Show all work

Answers

Answer:

1) 19.07 m, 2) 80.10 ft, 3) 56.79 m

Step-by-step explanation:

Use trigonometry to solve for unknowns.

1) Use sinesine = opposite leg / hypotenusesin 27° = x/42x = 42 sin 27°x = 19.07 m (rounded)

2) Use tangenttangent = opposite leg / adjacent legtan 23° = 34/xx = 34 / tan 23°x = 80.10 ft

3) Use cosinecosine = adjacent leg / hypotenusecos 48° = 38/xx = 38 / cos 48° x = 56.79 m (rounded)

#1

sin27=x/42x=42sin27x=19.07m

#2

tan23=34/xx=34/tan23x=80.1ft

#3

cos48=38/xx=38/cos48x=56.79m

help its timed 12 pts​

Answers

Answer:

A

Step-by-step explanation:

I think your right!

Answer:

B

Step-by-step explanation:

I think it means the roots, at which the line crosses the x-axis, in which case, the answer is B, 0 and 1.4

DNA molecules include the base units adenine, thymine, cytosine, and guanine
(A, T, C, and G). The sequence of base units along a strand of DNA encodes
genetic information. In how many different sequences can A, T, C, and G be
arranged along a short strand of DNA that has only 5 base units?

Answers

The number of ways different the sequences of adenine, thymine, cytosine and guanine can be arranged along a short strand of DNA with 5 base units is 120

What is permutation?

Permutation is the number of ways of arrangement for a given set.

The formula for a permutation is given as P(n, r) = n! / (n-r)!

Where n = items chosen from = 5

r is the number of items = 4

Substitute values into the formula

P(5, 4) = [tex]\frac{5!}{5-4!}[/tex]

P(5,4) = [tex]\frac{5 * 4* 3*2*1}{1}[/tex]

P(5,4) = [tex]\frac{120}{1}[/tex]

P(5,4) = 120

Therefore, the number of ways different the sequences of adenine, thymine, cytosine and guanine can be arranged along a short strand of DNA with 5 base units is 120

Learn more about permutation here:

https://brainly.com/question/11732255

#SPJ1

Answer:

The answer is actually 120.

Step-by-step explanation:

I have the keysheet to the questions.

Determine the x-intercept of the following equation.

(-x-2)(x-3)=y

Answers

Answer:

3,-2

Step-by-step explanation:

set y =0 and solve

(-x-2)(x-3)=0

the values 3, -2 solve the equation and are your x-intercepts

Which relation is a function?
{(-4,-7), (-9, 5), (4, -2), (-9, 0)}
{(-7, -7), (-2, 5), (−1, 6), (-2, −5)}
{(0, 1), (3, 2), (5, -3), (0, 2)}
{(-3, -2), (-1, 3), (0, -2), (3, 4)}

Answers

Answer:

Here's a little trick I learned in 8th grade. The first numbers don't matter all that matters are the 2nd numbers, and if you have 2 of the same kind of numbers then it's not a function so your answer would be B.

The solutions to a quadratic equation are x=4 and x=3/5. What is the original equation?

Answers

X squared - 4.6x + 2.4 = 0

Which of the following sets of ordered pairs represents a function?

{(-6,-1), (13,8), (1,6), (1,-10)}

{(10,5), (10,-5), (5,10), (5,-10)}

{(3,5), (-17,-5), (3,-5), (-17,5)}

{(10,5), (-10,-5), (5,10), (-5,-10)}

Answers

Answer:

Step-by-step explanation:

A function can only have one output for an input.  That is, for any value of x, there must be a unique value of y.

{(-6,-1), (13,8), (1,6), (1,-10)}   Not a  Function:  (1,6) and (1,-10)

{(10,5), (10,-5), (5,10), (5,-10)}  Not a  Function:  (10,5) and (10,-5)

{(3,5), (-17,-5), (3,-5), (-17,5)}   Not a Function:  (3,5) and (3,-5)

{(10,5), (-10,-5), (5,10), (-5,-10)}  Function:  No duplicate values of y for a value of x.

What is the value of p?

Answers

Answer:

p =43

Step-by-step explanation:

Finding the angle in a triangle

The angle next to 133, angle a,  is 180-133 = 47 because the angles form a straight line

The angle next to 90, angle b, is 180-90 = 90,  because the angles form a straight line

We have a triangle.  The angles in a triangle equal 180 degrees

a+b+ p =180

47+90+p = 180

137 + p = 180

p = 180-137

p =43

Please help thank you

Answers

Answer:

Line A: 4

Line B: -2

Step-by-step explanation:

Line A

Pick any two points from the graph such as (2, -1) and (3, 3)

Use the gradient formula to calculate the gradient:

Change in y/change in x

-1 -3/2-3 = -4/-1 = 4

The gradient of line A is 4

Line B

(1, -1) and (0, 1)

-1 - 1/1 - 0 = -2/1 = -2

The gradient of line B is -2

Answer:

Line A is 4.

Line B is -2.

Step-by-step explanation:

See attached image

Find the simplified product 2 square root 5x^3(-3 square root 10x^2

Answers

The simplified product of [tex]2\sqrt{5x^{3} }[/tex] and -3[tex]\sqrt{10x^{2} }[/tex] is -30[tex]x^{5/2} \sqrt{2}[/tex].

Given Two expressions: -3[tex]\sqrt{10x^{2} }[/tex] and 2[tex]\sqrt{5x^{3} }[/tex].

We have to multiply both the expressions and it can be done as under:

-3[tex]\sqrt{10x^{2} }[/tex] *2[tex]\sqrt{5x^{3} }[/tex]

Firstly we have to multiply -3 with 2 to get

=-6[tex]\sqrt{10x^{2} }\sqrt{5x^{3} }[/tex]

Then we have to find square root of x cube and x square which is x to the power 3/2 and x to the power 1.

=[tex]-6x^{3/2} x\sqrt{10}\sqrt{5}[/tex]

Now we have to multiply both the numbers in the root to get the answer;

=-6[tex]x^{5/2} \sqrt{50}[/tex]

Square root of 50 is 5 root 2.

=-6*5[tex]\sqrt{2}[/tex][tex]x^{5/2}[/tex]

=-30[tex]\sqrt{2}[/tex][tex]x^{5/2}[/tex]

Hence the simplified product is -30[tex]\sqrt{2}[/tex][tex]x^{5/2}[/tex].

Learn more about product here https://brainly.com/question/10873737

#SPJ10

A 2-column table with 6 rows. The first column is labeled t with entries negative 3, negative 2, negative 1, 0, 1, 2. The second column is labeled f of x with entries negative 12, m, 4, 0, negative 4, negative 2. If the table of the function contains exactly two potential turning points, one with an input value of –1, which statement best describes all possible values of m? m ≥ –12 –12 < m < 4 m ≤ 4 m ≥ 4 or m ≤ –12

Answers

Answer: obviously 9

Answer:

B

Step-by-step explanation:

right on edg3


In which part of the graph is the distance from home decreasing?

Answers

Answer:

A) 2

Step-by-step explanation:

Because the slope is negative of line 2 the distance is getting smaller

Option A because the value is decreasing

cos2pi/7+cos4pi/7+cos8pi/7=1/8

Answers

An equation is formed of two equal expressions. The given equation is not true.

What is an equation?

An equation is formed when two equal expressions are equated together with the help of an equal sign '='.

The complete question is: Check whether the given equation is true or not?cos2pi/7+cos4pi/7+cos8pi/7=1/8.


To know if the given equation, [tex]cos\dfrac{2\pi}{7}+cos\dfrac{4\pi}{7}+cos\dfrac{8\pi}{7}=\dfrac18[/tex] is true or not, both the sides of the equation are needed to be solved separately.

The value of [tex]cos\dfrac{2\pi}{7}+cos\dfrac{4\pi}{7}+cos\dfrac{8\pi}{7}[/tex] when simplified is equal to -0.5, or the value can be written as -(1/2).

Since the right side of the equation is equal to -1/2, while the right side of the equation is 1/8. Thus, the given equation is not true.

Hence, the given equation is not true.

Learn more about Equation:

https://brainly.com/question/2263981

#SPJ1

solve : y+3=10 solve the question​

Answers

The answer is seven
Y equals ten minus three

Answer:

y+3=10

solution,

y+3=10

y+3-3=10-3

y=7

thus,

y=7ans

If function g has the factors (x - 7) and (x + 6), what are the zeros of function g?

Answers

Function Equations

When a given function is written with factors in the form of ( x - r ), then r is a zero of the function.

Solving the Question

We're given:

Function g has factors (x-7) and (x+6)

Therefore, the zeros of the function are 7 and -6.

Answer

-6, 7

The zeroes of the function will be equal to ( 7, -6 ).

What is a quadratic equation?

It is a polynomial with a degree of 2 or the maximum power of the variable is 2 in quadratic equations. It has two solutions as its maximum power is 2.

Given function:-

( x- 7 ) ( x+ 6 )

As we can see that the quadratic equation in the factorized form is ( x - 7 ) ( x+ 6 ) so we will equate each factor to zero.

( x- 7 )  = 0

x = 7

( x+ 6 ) = 0

x = -6

Therefore zeroes of the function will be equal to ( 7, -6 ).

To know more about quadratic equations follow

https://brainly.com/question/1214333

#SPJ1

If s(x) = 2 – x² and t(x) = 3x, which value is equivalent to (sof)(-7)?
-439
-141
153
443

Answers

Answer:

- 439

Step-by-step explanation:

evaluate f(- 7) and substitute the value obtained into s(x)

f(- 7) = 3(- 7) = - 21 , then

s(- 21) = 2 - (- 21)² = 2 - 441 = - 439

Answer:

A. (s*t)(-7)=-439

Step-by-step explanation:

(s*t)(-7) is the same as s(t(-7)). First find t(-7)

t(-7)=3(-7)=-21

t(-7)=-21

Plug -21 into s(t(-7)) for t(-7).

Find s(-21).

s(-21)=2-(-21)^2=-441+2=-439

Hope this helps!

If not, I am sorry.

Its math please help

Answers

Answer:

g

Step-by-step explanation:

for this function, we put in the value of "g" (because it is the cause of the function--it is the independent variable [it changes; and it doesn't rely on something else to change] )

so, because the part independently changing is the gas used, that is our input of this graph.

(you can imagine this to be a graph, which typically has the independent variable that we are directly changing--x--along the x-axis, which is where we would place g.)

hope this helps!!

14-8+3+8x(24÷8)

tell accordingly and i will mark every answer as brainliest

Answers

Answer:

33

Step-by-step explanation:

Apply BODMAS(Brackets Of Division Multiplication Addition Subtraction)

Answer:

+33

Step-by-step explanation:

first (24÷8), 8x(3), 14-8+3+24 =33

The sides of the base of a right square pyramid are 10 feet long. The slant height is 15 feet. When the side lengths of the base and the slant height are both multiplied by a factor of 4, by what factor is the surface area multiplied?

Answers

The surface area is multiplied by a factor of 16

How to determine the factor of the surface area?

The dimensions are given as:

Base = 10 feetSlant height = 15 feetFactor, k = 4

The factor of the surface area is calculated as:

Surface area = Factor^2

So, we have:

Surface area = 4^2

Evaluate

Surface area = 16

Hence, the surface area is multiplied by a factor of 16

Read more about scale factor at:

https://brainly.com/question/3457976

#SPJ1

16

Step-by-step explanation:

A function that models the profit for a new pet-monitoring system shows that there is no profit made until the price reaches $95 per unit, a maximum profit at a price of $140 per unit, and no profit at a price over $185 per unit. Which graph models the function?

Answers

The profits at x = $185 is 0 and the graph is attached below:

What is graph?

Graph is a mathematical representation of a network and it describes the relationship between lines and points.

Function is to model the profits of a new pet-monitoring system, so, if the profits are y and x then y = f(x)

The curve shows that y is negative at values of x< $95, then the profits increase when x varies between $95 and $140.

The profits reach a maximum at $140 and then the profits start to reduce as x increases again.

So, the profits at x = $185 is 0.

Learn more about this concept here:

https://brainly.com/question/16887458

#SPJ1

Answer:

a on edge

Step-by-step explanation:

I js did it

Select the correct answer.
Edwin graphs the relationship of the gallons of milk he buys in terms of dollars.

Answers

The answer is c Sam buys gas at a slower rate of 3.4 mile per gallon

Lewis wishes to make a scale drawing of his mansion. If his mansion is 50 feet tall, and he wishes to scale is diagram so that 3 inches represent 8 feet, how tall is the mansion on paper?

Answers

Answer:

18.75 inches

Step-by-step explanation:

Inches:feet

3. : 8

X. : 50

(Cross multiply)

8x=150

X=150÷8=18.75

The area of a rectangle is 20 square meters. The length of the rectangle is (x-3) meters and the
width of the rectangle is (x - 2) meters. Find the length and the width of the rectangle.



With steps and explanation please.

Answers

Answer:

length = 4 cm

Width = 5 cm

Step-by-step explanation:

Area of rectangle:

      Area of rectangle = length * width

length = (x - 3) meters

Width = (x - 2) meter

Area = 20 square meters

  (x - 3)*(x - 2) = 20

Use FOIL method.

   x*x + (x)(-2) + (-3)*x + (-3)*(-2) = 20

                         x² -2x  - 3x + 6 =20

         Combine like terms

                        x² - 5x + 6  = 20

Now subtract 20 from both side

                     x² - 5x + 6 - 20 = 0

                           x² - 5x - 14  = 0

Factorize the equation and find the roots

         Sum = -5

   Product = -14

    Factors =  (-7) , 2

When we add (-7) + 2 = -5 and when we multiply (-7)*2 = -14

x² + 2x - 7x - 14 = 0

 x(x + 2) -7(x + 2) = 0

 (x + 2)(x - 7)  = 0

  x - 7 = 0    {Ignore (x + 2 = 0) as measurements wont't be in negative}

x = 7

length = x - 3

          = 7 - 3

   [tex]\sf \boxed{\bf length = 4 \ cm}[/tex]

width = x - 2

         = 7 - 2

    [tex]\sf \boxed{\bf width = 5 \ cm }[/tex]

In studies that use more than one data collector, how is the consistency of the data evaluated?.

Answers

In order to evaluate consistency in studies with more than one data collector, the Inter-rater reliability is used.

What is the Inter-rater reliability?

This is a measure in research that is used to test the data presented by different data collectors, for consistency.

It essentially checks the extent to which the data collected from the different sources agree with each other.

Find out more on Inter-rater reliability at https://brainly.com/question/24711327.

#SPJ1

Imagina that the cook is using a potato-chopping machine instead of a knife, allowing him to chop a maximum of 120 potatoes instead of 100. Which is the best estimate of the number of hamburgers he could cook if he chopped 100 potatoes with the machine

Answers

The number of hamburgers he could cook is 14 if he chopped 100 potatoes with the machine option (B) is correct.

What is the graph of the best estimate?

A mathematical notion called the graph of the best estimate connects points spread throughout a graph.

The question is incomplete.

The complete question is in the picture, please refer to the attached picture.

We have shown a graph in the picture that shows the number of hamburgers cooked versus the number of potatoes chopped.

As we can see in the graph,

Number of potatoes chopped = 80

number of hamburgers cooked = 30

Number of potatoes chopped = 90

number of hamburgers cooked = 20

Number of potatoes chopped = 95

number of hamburgers cooked = 10

Number of potatoes chopped = 100

number of hamburgers cooked = 14 (best estimate)

Thus, the number of hamburgers he could cook is 14 if he chopped 100 potatoes with the machine option (B) is correct.

Learn more about the graph of the best estimate here:

brainly.com/question/14279419

#SPJ1

Function h is a transformation of the parent exponential function. Which statement is true about this function?




As x approaches positive infinity, approaches 0.

As x approaches negative infinity, approaches positive infinity.

As x approaches positive infinity, approaches positive infinity.

As x approaches negative infinity, approaches negative infinity.

Answers

The statement that is true about this function is C. As x approaches positive infinity, h(t) approaches positive infinity

Calculations and Parameters

Given that we have:

The domainThe rangeThe function

Therefore, when x approaches to negative infinity,

[tex]\lim_{x \to \infty} h(x)[/tex]

= 2^(-∞-5)

= 2^(-∞)

= 1/2^∞

=0

Also, as x approaches negative infinity, function h(x) approaches 0.

Then when x approaches to positive infinity,

[tex]\lim_{x \to \infty} h(x)[/tex]

2^(∞-5)

= 2^(∞)

= ∞

Therefore, As x approaches positive Infinity, h(x) approaches positive infinity.

Read more about transformations here:

https://brainly.com/question/17936416

#SPJ1

Mr. Browner has 7 keys. He has 1 key
for his home, 2 keys for his car, and
the rest are for drawers in his office.
If Mr.
Browner picks one of his keys
without looking, what is the probability
it is for his car?

Options: 1/7, 2/7, 3/7, 5/7, 6/7

Answers

Answer:

2/7

Step-by-step explanation:

there are 7 total possibilities for the keys he picks, and out of those possibilities, 2 of them are car keys. this means the probability that it is for his car is 2/7.

[tex]\huge\mathscr\color{gold}\colorbox{black}{ANSWER:}[/tex]

[tex]{\qquad\qquad\qquad}[/tex]

You can choose Options: 2/7

[tex]__________________________________[/tex]

[tex]\large\mathcal\color{gold}\colorbox{black}{STEP-BY-STEP\: EXPLANATION:}[/tex]

[tex]{\qquad\qquad\qquad}[/tex]

Will i can choose 2/7 because 7 is probability keys he picks, and 2 keys he picks for looking a drawers in office to finding.

[tex]__________________________________[/tex]

Hope it helps

Correct me if I'm wrong

[tex]__________________________________[/tex]

[tex]\normalsize\color{brown}\boxed{☕TheQuestionner☕}[/tex]

Marvin uses apples to make apple bread the ratio of apples to loaves is 12:2 what is the equivalent ratio for 5 loaves of bread

Answers

Answer:

dSutlrysl07tris5eiruwf3rtst47er747y3utgxgudjdudufnlgjfngvi

Other Questions
The Wilson family had 5 children. Assuming that the probability of a child being a girl is 0.5, find the probability that the Wilson family hadat least 3 girls? at most 3 girls? The quadrilateral below is formed from a parallelogram and anisosceles triangle.Calculate the size of angle VQU. read the direct speech below and complete the indirect reporting that f fllows question number 1 I overslept this morning La ltima frase nos desvela el suceso que est ocurriendo en el texto qu gran suceso es ese Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom describe the required qualifications occupation of dentist knowing that the client has two risk factors that cannot be modified, which intervention is most important for the nurse to include in the client's plan of care? Which of these was an accomplishment of the Han Dynasty?A.The invention of paper B. The discovery of a water passage to Europe C. The invention of the ballpoint pen D. The invention of the abacus A journey i have made A sequence is defined by the recursive function f(n + 1) = one-half(n). If f(3) = 9 , what is f(1) ? Add.(3+x3+3x2)+(2x324x2)Express the answer in standard form.Enter your answer in the box. Lorenzo and Lila own all of the Double L Corporation's stock. The stock of this corporation is not sold to the general public. Lorenzo and Lila own a(n) The sin (0) = - and lies in Quadrant III. Find the exact values of the sine6'and cosine of 20. write an essay explaining why it is important to work hard Romes government before the first century AD was a republic. Explain what this meant and how the rise of powerful generals challenged the idea of a republic. 1 in = 2.54 cmhow many millimeters are in 10.5 feet?A.266.7 mmB. 1,260 mmC. 320.04 mmD. 3,200.4 mm Think about all of the ways in which a circle and a parabola can intersect.Select all of the number of ways in which a circle and a parabola can intersect.0012030405DONE Question 1 of 32How does soil begin to form?A. Rock particles clump together in an aggregate.B. Sediment stays and settles in a location.C. Bedrock breaks down into smaller particles.D. Sediment moves to a new location. What are the main strengths and weaknesses of each of the competitive strategies: home replication, multidomestic, regional, global, and transnational? What challenges arise under each approach in terms of building and leveraging knowledge that can yield competitive advantage, and what can companies do to enhance the effectiveness of their knowledge management efforts under each approach? which statement about incumbency is most accurate?